SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PB22354-RA from Pogonomyrmex barbatus v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PB22354-RA
Domain Number 1 Region: 45-283
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 3.01e-100
Family Inorganic pyrophosphatase 0.0000000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PB22354-RA
Sequence length 285
Comment protein AED:1 QI:0|0|0|0|0|0|6|0|285
Sequence
MSLVTLHVLRCHGLARLVIPSRFIATGGRISKRFIDCFTKLCRNMYTTVEKGALNSTDYR
IFFKNDLGFPISPMHDIPLYANEENKIMHMVVEIPRWTNAKMEICLKEPLNPIKQDVKKD
KLRFVANCFPHHGYIWNYGALPQTWENPDVLDEATGCKGDNDPIDVLEIGYRVAKRGEIL
KVKVLGTVALIDEGETDWKIIVIDVNDPLADQMNDISDIEKHCPGLLKATIEWFKIYKIP
DGKPENQFAFNGEAKTREFALHIIDEVHQHWQNLVKQEDSSGEIE
Download sequence
Identical sequences PB22354-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]