SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PB13678-RA from Pogonomyrmex barbatus v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PB13678-RA
Domain Number 1 Region: 104-130,249-472
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.16e-53
Family Nuclear receptor ligand-binding domain 0.0000688
Further Details:      
 
Domain Number 2 Region: 51-134
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-30
Family Nuclear receptor 0.000051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PB13678-RA
Sequence length 480
Comment protein AED:1 QI:0|0|0|0|0|0|6|0|480
Sequence
MAGPDLIILIEAGWYANKHRRNELCIGLDIVEHEQHYAAADSNSSTPAKSFVPCKVCGDK
ASGYHYGVTSCEGCKGFFRRSIQKQIEYRCLRDGKCLVIRLNRNRCQYCRFKKCLAVGMS
RDSVRYGRVPKRSRERGPEDTMATTMTTTTTTTTMATMEMQQLTTPDTGNNNASNKNNNN
NNNNNNNNNNNTQSQNAISRVPSAAVVEADQSDADVKQLAVYDVIHQVSQAHHAHCGFTE
ESTRGLTRKPMIIPPASPEDPEAASSTAETVESQRIWLWQQFATRVTPSVQRVVEFAKRM
PGFCELSQDDQLILIKVGFFEVWLCHISKMTTDNSMTFEDGTYFTRQQLELMYEPDFVSA
LMQVTSSLNAHQLTDTELGLFSAAVLLSERPGLNDVKAVQRLQDRVLEALRVQATRPSGE
GAGGTVTTITSVSQRIPELRTLGARHANLLDWFRRNWTKLKLPPLFAEIFDIPKCEEDLQ
Download sequence
Identical sequences PB13678-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]