SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PB17347-RA from Pogonomyrmex barbatus v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PB17347-RA
Domain Number 1 Region: 215-229,291-533
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.49e-42
Family Nuclear receptor ligand-binding domain 0.00027
Further Details:      
 
Domain Number 2 Region: 146-226
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.85e-30
Family Nuclear receptor 0.0000972
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PB17347-RA
Sequence length 544
Comment protein AED:1 QI:101|0|0|0|0|0|9|0|544
Sequence
MDRDHREQRDHNNLSEKEPDCKVGMDFRSLSHHRDRTPDADAERDMDIDSADRIENLHDD
KSEKLGRNFHNIGHHPAMRDVDRDQNNHVDNMHDDKMDHKIGRDFRISAHPGMVHLHSSM
EHLTNVDVEVKLARDVRGSLGLGLSLELCVVCGDRASGRHYGAISCEGCKGFFKRSIRKQ
LGYQCRGSKSCEVTKHHRNRCQYCRLQKCLAMGMRSDSVQHERKPVLGDSTATKVGNRSP
RVKPEPQQSAPEAPPTWEQPESPGMEDQSSDSDLSDALTLARERLLISHALDSMAKIIGD
NVNGSSEPEEEWTGQLISERNTLFELRAPSPAPVYLSIHYICESAARLLFLSVHWAQGIP
AFQALPSDVQTTLVRSSWGQLFTLGLAQCAYTLSLPSILTSIINHLQASIAQEKVTASKV
KCVTEHICRLQDCVSSLHKLQVDSVEYAYLKALTLFSADNILAGIWRKKVEVLQEAACTE
LQQRVGSDRLPRLLLRLAPLRSINPRVLEDLFFSGLIGRVSVASVVPYILTMQDYKTEPE
SHAG
Download sequence
Identical sequences PB17347-RA XP_011634902.1.19355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]