SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PB18811-RA from Pogonomyrmex barbatus v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PB18811-RA
Domain Number 1 Region: 324-406
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.55e-29
Family Nuclear receptor 0.00023
Further Details:      
 
Domain Number 2 Region: 397-408,529-653
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.14e-17
Family Nuclear receptor ligand-binding domain 0.0019
Further Details:      
 
Weak hits

Sequence:  PB18811-RA
Domain Number - Region: 88-174
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0128
Family beta-sandwich domain of Sec23/24 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PB18811-RA
Sequence length 747
Comment protein AED:1 QI:0|0|0|0|0|0|7|0|747
Sequence
MADTSTLSPEANMPGSPGCPVVRVTSEYLLGSPSPGTPRGSDSLRGTGGSDGGGRGSGQE
GRDATCLDRASPDSVFPDAGPMVSFRIADEQQQQHHQQSQQQHHHQQQQQQQQQQQQQQQ
QRSATPVPIKSSPYSPVQAVSSTPITQEASSRSDSEGMKPPAQRAAPAPPRPPPTVLMGE
IGGVRTMIWSAPPLDPVPPPAASWSATAAAAASCSSTEESAAQLLLNLGQESRGKPPSSS
SAVSYSSAAGPPLNMERLWAGDLTQLPAAQQMQALNLTASGSAAQPWVSNGGTIVKSEAA
SQSISVAPPAPPMPPQEHEEDETPMICMICEDKATGLHYGIITCEGCKGFFKRTVQNRRV
YTCVAEGGCEITKAQRNRCQYCRFKKCIEQGMVLQAVREDRMPGGRNSGAVYNLYKVKYK
KHKKSNKTGSVGGGMSGGSNVGGVNGSGTLGGTKGAMGTTMLDKHMAAAAAAHHSQQQQQ
QHSQLAGSFLHHHKISSGDPLSSPPTPSHPSHPAHSGHLVNGTILKTALTNPSEVVHLRQ
RLDNAVSSSRDRVFPLDATLTMIQTLIDCDEFQDIATLRNLDELLDHNSDLSEKLCQIGD
SIVYKLVQWTKRLPFYLELPVEVHTRLLTHKWHELLVLTTSAYQAMHGQHRLTNVGTDGT
GADFMQEQDECEFGGLIQSSQLGNEQHVYVANVPNQHDGSADNHGPIAARRRAHGGKNHI
CHANVQASEATDGGVCLSKSNHYALTR
Download sequence
Identical sequences PB18811-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]