SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PB24138-RA from Pogonomyrmex barbatus v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PB24138-RA
Domain Number 1 Region: 2-136,170-278
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 1.01e-68
Family Tubulin, GTPase domain 0.00000298
Further Details:      
 
Domain Number 2 Region: 279-485
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 3.97e-57
Family Tubulin, C-terminal domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PB24138-RA
Sequence length 495
Comment protein AED:1 QI:198|0|0|0|0|0|11|0|495
Sequence
MPCEMITLQLGQCGNQIGFEFWKRLCAEHGINPEGILEDYATEGMDRKMFFYQSDDEHYI
PRAVLLDLEPRVIHTIMNSPYSKLYNPENIYLSKHGGGAGNNWASGYHQGEKLQEEIFDI
LDREADGSDSLELSLKNWTVSIFHTVSGSQNYTFKGELKKLYHKKGFVLCHSIAGGTGSG
MGSFMLESLADRFPKKLIETYSVFPNQDEISDVVVQPYNSLLTLKRLTQCADCVVVLDNT
ALNRIASDRLHIQNPSFTQINKLVSTIMSVSTTTLRYPSYMNNDLVGLIAPLIPTPRLHF
LMTGYTPLTTDQEGASVRKTSVLDVMRRLLQPKNMMVSTALDRNASHCYISILNIIQSRT
LAVRRKGGEVDPTQVHKSLQRIRERKLAQFIPWGPASIQVALSRKSPYIQSTHRVSGLML
ANHTNISSLFDRALQQFDKLRKREAFLEQFRKEKMFEDNLDELDNSREVVEYLVEEYQAA
TRIDYLSWNPTKADT
Download sequence
Identical sequences PB24138-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]