SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PB25805-RA from Pogonomyrmex barbatus v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PB25805-RA
Domain Number 1 Region: 50-123
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000146
Family PDZ domain 0.062
Further Details:      
 
Domain Number 2 Region: 148-205
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000179
Family RING finger domain, C3HC4 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PB25805-RA
Sequence length 522
Comment protein AED:1 QI:0|0|0|0|0|0|4|0|522
Sequence
MPHFSCSEVLTEAAGVKIITSLPKEDMNSHSPGKMVLKMRKVHAGSCMHGKSCGFHLTKS
KWDPYPWVGYVEDNSPADLAGLRSGDCLLGIDDTDLLGLKIKDIAILIRNKENTQDLTFF
IWRYTHQEEEQNDTGLALKGPLPNVAKNLANALSGTVHALECPICLESATPPVSQCVHGH
ILCVVCRPKTSRCPVCRVRLGQGRCLLADKLHRVLRDTFNVNNDETINKTASGHYNLRGQ
LFGKKSSKRQETSIANQSKNNCAMLKPRQFLLARLLLGGREKAASADNLTKVSEISEEAV
TIPDGATNINSLRVRLSLNDRTKSASTGELSRDSKARINDSSSRIVEASTMDFSQQSLSL
PQTPRWGGSTDSISCVQLTCPFLQSCKEVVTCDSLLEHIRTHAIPQVHFYSGNARIPFPL
PFGHEALYIFHHGNNIFFFQCKDEMAWMTYPPRMTHSNSRWEWTLHAWGDNDTDVQLRKP
VASLEDSAILSSQYIASLPNTLLLKAIDIQISEYRAHDRLYV
Download sequence
Identical sequences PB25805-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]