SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PB26114-RA from Pogonomyrmex barbatus v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PB26114-RA
Domain Number 1 Region: 105-407
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.64e-34
Family NodB-like polysaccharide deacetylase 0.02
Further Details:      
 
Domain Number 2 Region: 35-97
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 2.88e-16
Family Tachycitin 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PB26114-RA
Sequence length 483
Comment protein AED:1 QI:186|0|0|0|0|0|9|324|483
Sequence
MRLQEAALLCAVLTVVAVHCQKNKKDEDKKDEEFRCPEGQGNGNFADPATCRRFYQCVDG
YPYLNRCPSGLHFDDISKFCTFKNEARCGPIEATPAPITEPPTDLAERCDTANCQLPYCF
CSRDGTIIPGGLHPEETPQMIIMTFDGAINHNNFDHYQKIFTQDRLNPNNCPLRGTFFIS
HEYCNYNMVQSLAHDGHEIATETISLQKGLEDKGYEEWVGEMIGMREILKHFSNISTGEV
VGMRAPYLKPGRNTQYKVLEDFGYIYDSSIGISPLKVPIWPYTLDYKIPHECKAGTCPTK
SFQGIWELPLNAHYVESYEGGHCPYLDQCVLHNHDPEEVFEWLQEDFNRYYEQNRAPYMM
PFHTNWFQIKELERGLSKFLDWVVTLPDVYFVTATQALTWMTDPKPIKALHNFEGWSCKK
KENLPGPPCNNPHKCALDFKPPEANFTTTRYMETCRECPNKYPWLGDSKGTGLYNDNYNP
EKK
Download sequence
Identical sequences PB26114-RA XP_011646559.1.19355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]