SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PB26138-RA from Pogonomyrmex barbatus v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PB26138-RA
Domain Number 1 Region: 555-751
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.02e-45
Family Nuclear receptor ligand-binding domain 0.00036
Further Details:      
 
Domain Number 2 Region: 11-97
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.48e-26
Family Nuclear receptor 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PB26138-RA
Sequence length 754
Comment protein AED:1 QI:0|0|0|0|0|0|6|0|754
Sequence
MDDEQPAREANKICGVCGDRALGYNFNAVSCESCKAFFRRNALKNKDFRCPFTENCNISP
ITRRFCQKCRLDKCFSIGMRKEYIMSEEDKVLKRKKIEKNRAKKRSQTENDKTSKIKKDC
MDDYTFEDTSMSINLAGSTMSETYFWESNRKYTDLDGNKQNTVESMSPVTAVSVPSPSSP
PENTNIAETKTLDMLKESVHGSRSNLASRTRFTDFNMSSQNVGMDKNSPSNSGKYEQNPR
QLSSEFVDVNRESSRYSSAFEENVHSYSKFDQTREQNSPVYDNSLASYSGASRSTPNSPH
MQLAKDEASICQKPKETCSSGNNLIVKFKQDPGLLTKFVNNPNLVAKIFQDRRVIMKIMT
DPDMVTCLAADPHITQFLEEHDAIDTTITERDRDIKTKGQPKEGSSIPINSDSLSDNTVR
HVPKAKGSHVENPILTDLITNRNAEEGKNQNLESNTNTDWNKNTADVTRDVLQDVQRIPI
AANSIESILCEAIKLEYSAFSSFGGNQSSRELNDAERAKLNELIVANKALLAPLDDDITN
LVGEECKFKNNFGQSDPMLLDVINLTAIAIRRLIKMSKKINAFKNMCQEDQLALLKGGCT
EMMILRSAINYDPDKDMWKIPHSQESMSNIKVDVLKEAKGNLYAEHARFVRTFDPRWRDE
NIILILSAIALFTPDRPRVVHGDVIKLEQNSYYYLLRRYLESVYPGCEAKSTFLKLIQKI
SELHKLNDEVVGVYLNVNPSSVEPLLIEIFDLKH
Download sequence
Identical sequences XP_011646603.1.19355 XP_011646604.1.19355 PB26138-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]