SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PB26692-RA from Pogonomyrmex barbatus v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PB26692-RA
Domain Number 1 Region: 97-135
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000055
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 2 Region: 52-88
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 3 Region: 5-45
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 134-178
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000128
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PB26692-RA
Sequence length 183
Comment protein AED:1 QI:0|0|0|0|0|0|5|0|183
Sequence
MDQTYRKCQPDDFRCVGTTPELCIPKEKKCDGYLDCRNGRDEERCENNMKPACRLDQFRC
NTTQRCVEQSARCNHWDDCGDNSDEEHCNGRLQDESFPPCTSDQFRCANALCIPIAYQCD
GYKDCQDGSDEKSCTLTVCPGNKFMCPKGATDGKPLCINRSQLCDEKQDCEDGADEEAAC
FVE
Download sequence
Identical sequences PB26692-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]