SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PB26696-RA from Pogonomyrmex barbatus v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PB26696-RA
Domain Number 1 Region: 72-115
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000000458
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 2 Region: 113-151
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 3 Region: 153-195
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000602
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 193-235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 39-74
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 6 Region: 279-316
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 7 Region: 242-277
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000681
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PB26696-RA
Sequence length 338
Comment protein AED:1 QI:0|0|0|0|0|0|4|0|338
Sequence
MQSLPKLTQICGCPYGERLQSNGRSCAVDPDGEPPLQACPHTWDFTCANQRCVPKSWVCD
GENDCLDNSDEMQNCTKPTCSANEFQCKSGRCVPMTFHCDSENDCGDYSDEMGCPNITCS
ANQFACANNRCIPATWKCDSENDCGDSSDEGEFCAAKTCSYFQFTCPRSGHCIPQSWVCD
GDSDCFDQQDEMDCPPVTCLSTQFTCADQKMCVLASYKCDGISDCNDGSDEVGCPSLAPD
QCNTDKQFQCVSSAICIPRSWYCDGTADCPDKSDEPDSCGKVDCQNGFFRCRNEKCIFKA
YICDGKDDCGDNSDEDTELHACGPPIFKCEAEHWKYWI
Download sequence
Identical sequences PB26696-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]