SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for pbar_TepIII-RA from Pogonomyrmex barbatus v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  pbar_TepIII-RA
Domain Number 1 Region: 957-1252
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.94e-87
Family Complement components 0.0000168
Further Details:      
 
Domain Number 2 Region: 1327-1463
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 2.22e-34
Family Alpha-macroglobulin receptor domain 0.00079
Further Details:      
 
Domain Number 3 Region: 791-840
Classification Level Classification E-value
Superfamily E set domains 0.0000434
Family SVA-like 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) pbar_TepIII-RA
Sequence length 1507
Comment protein AED:1 QI:0|0|0|0|0|0|29|0|1507
Sequence
MAKFNRRNVRQTAELRSTDFPIYGINKYDQEHLANIEVENIFTTMYYTIIAPKVVRPDSE
YNVAASVTAVSTPSAIYIELSGELDTGKIFNISRTAVVEPYSTQILRLDIGETTPGKYKL
IARGLSGIDFYKSVDVEYVHKSYSVFIQTDRAIYKPGHKVMFRCIILDSRLRPSIVRPTD
IYIIDGDGNRIKQWNRPPVTHGIFGSELELSQSPVLGKWKLIANVGDQTFEKEFEVAEYV
LPNFEVTIDSPKHVQFKESKITATVQAKYTYGKPVKGEATITVYPDIFSGVIQPIFQQPV
RKVVPINGKVTVDFDILSELRLTDEYERPVMIDVVVEEELTTRRQNTSIQITLHKHKYTM
ELIRTSEYFKPGLKYTAFLKLTYHDGSPVQDIKNDVLIAYGYTYNQSAYSNITRKLDEHG
MVQLDFYPPKAKDNISFPLNIEAQYLNLHEWFPSTNQATSLSNEYIQAILKTEKPMVNNY
IEIEVNSTTPLKYVSYEVLGRGNILDAGSIYVQDKYTTSFRFLATYVMTPTAHVIIYYIR
TDGEVIADSLDVELSGILQNHVDIKITLGEVMPGESVNLVISTKPNSFVGLLGVDQRSLL
LKSGNDISYEQVYKELQSYDKAEVSPHTDAFFGRPLWRPGSGTADDVFQKTGLIILTNGY
VHENFPIQYTIHQITMGAIHNQFLHLRLFKIISSRALDGLKISLIYYRSSFEDVMYASPA
AFSGQAAALPPEKIKVRKNFPETWLWQTLDAGYNGKTELRRNVPDSITSWVLTAFSVNDA
HGLGLIEEPRKVFKPFFISIDLPYSVIRGEIVGIQIVVFNYMNKDLITEVLLTNEGQFDF
AEVSNEVHDAPKLELYRTKKVDVKANSGSTVSFMIIPRELGYISIKATANSVLAGDSVEH
KLFVNAEGETQYRNEAVFLDLRNVEQTSANVTINIPNNAVPGSENIQISAVGDILGPSIP
NLANLIRMPFGCGEQNMLNFVPNIVILNYLKNTNQLTQAVQSKALKYLDIGYQQELTYKH
TDGSFSAFGMSDSSGSTWLTAFVAKSFKQAAEYIAIENRIINGALEWLSNNQAPNGSFPE
VGKVSHRDMQGGAAKGLALTAYTLIAFLENEESVGKYRNTINKAVDYIVRNMEGLNDTYA
LSLCAYALNLAKHPYETSAFNFLESKAMRKQDLKWWSKPIPKDDKNPHYSLPRSVDVEMT
SYALLLYLRRNLVADAIPVMKWLVKQRNTEGGFASTQDTVIGLQALAKLAEKLSKDTNSV
RITYKYEGKGEGYMNINSGNSMILQKQILPAKTRFVNITASGKGFVLVQISYQYNLNVTG
AWPLFTLDPQVDKNSNANHLQLSICSGFVPTKEANESNMAVMEVSLPSGFTVDRDSLPSL
EISSHVKRVETRNGDTMVVLYFDKMVKQEYCPTVSAFRTHKVAKQKPVPVSIYDYYDSSR
RARVFYEPRQTTTLCDLCEDEDCEDICISKPGKRKDNVTVSAASHNYISVYLQFTFFSFY
FLLYKYL
Download sequence
Identical sequences pbar_TepIII-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]