SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for pbar_krimp-1 from Pogonomyrmex barbatus v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  pbar_krimp-1
Domain Number 1 Region: 967-1006
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 2 Region: 1036-1076
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000275
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) pbar_krimp-1
Sequence length 1160
Comment protein AED:1 QI:0|-1|0|0|-1|0|1|0|1160
Sequence
MQPVTTESAYRFTIKPAVTIGNPILEAFPEEAQRRRFPTFILRNFSRYLTKITPKSKDNN
LSSQYKLQNTELERYRKPDPKNCGNNVKICHLIVNQILSQLNDKSQIPKPLELSDNLLKS
LEIYKRTFPFHLQSVHLQSADSDQKMTGESNSDCTPKKSNTSNAIVNVLYGSKNDKYTST
KDVSKSNNSIIRNTLSKTKTDYQNNLDINNAKTMNYLKNGTSEAKKDIYNEKMSKKNNHL
LPPEKSTDTQRNNKWICKLIGDKFTACRQYNSTKVLNKPSNMTISIITAVSNNVDTNLNF
NATNVSDGNKIMKKTSSRKYGPAYQEYYNKYLKNYSTLSSTIKTIESIDMRASTIKSTLL
KGADEYKITEAWKTEKEDTTTTVKSTYFNTSVDNIYKQKLQNYIKTRNNNMNSRDNFFGH
KVKKDGKAAYYFNKYLKQHHVTRRTISVEDMDEIVEYVTANIQYNQTMKEAASSLSKEMS
ARPKASKNDYSSIKTEKLLYESNSPKVEIRRHFQAINDIDIVSNLSSSNNSIQQNYDRDN
EKRNMSKTHEQSGARTFETFNESNGNSTRNEDKIDSGLINSDETPESITANDHTTAEESR
ESKETLEESSRDDFDVLILNLTTTTRAPEIVTRDANESREVTSTESHGKREHKSRHNGRK
NNRPKKKKKKKNRNAKRKGESTLAWEVDKPTSVDYGNASEQTKTTFSHNDPGYDKVDNNR
NTSTGRNDWNFTDEITTESIKGEFSNTDGSVSEHPTENNIHNSLQSEKTTDADLVTTSQL
LTTSNGESSKKCKIRITTTTENNWFFRWISDEKIDEESNECEEDVVSTTSNSIDEKTSYY
STSISDDSSTYNKVSTLDGTTWKSFSNENDDISSEEMNTSKNEEDNDREDTIRKPILDEE
SNEDNEAIEYLESITHFIRGGATTDVNLNLDSEEEEEEYAGQEKFISSEDNDIDNGPVNA
DDYENDHCNENQHACDKYMCIEEDQLCDGIVDCFNANDETDCDYIYTRRLEEHLRVNKEQ
NELNSFSNEDTSLDGCDLYEHPCDGKCINALNVCDGKRDCLDGTDEGNCTEGILNIENNI
LQEKSVGFALRLRCKKFLALNGTRTSRGISSQRDVIFETTCHLRCIKTGFKDIRLVNTWT
FLGNCRDPIGKKDLRMLLFN
Download sequence
Identical sequences pbar_krimp-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]