SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Wican1|69788|estExt_Genemark1.C_4_t20372 from Wickerhamomyces anomalus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Wican1|69788|estExt_Genemark1.C_4_t20372
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily DNA clamp 7.14e-40
Family DNA polymerase processivity factor 0.00000373
Further Details:      
 
Domain Number 2 Region: 127-257
Classification Level Classification E-value
Superfamily DNA clamp 1.36e-34
Family DNA polymerase processivity factor 0.0000082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Wican1|69788|estExt_Genemark1.C_4_t20372
Sequence length 258
Sequence
MLEAKFDEAILFKRIIDAFKDTVQLCNFNCTEHGITVQAVDDSRVLLVSLLVGEDAFQTY
RCDRNITLGVDLSSLAKVLKCGNNSDSLTLIAEDSPDSVLVVFEDTVKDRISEYSLKLMD
IESDFLNIDDMDYDSVITLPAVDFQKICRDLSQLSDSLTVLVTKDTVKYVANGDIGSGSV
IVKPFTDLEKTENSVKVELNKAVNLTFGLKYLLDVIKGTSLSSTITIKLADKTPALFEFK
LPSGYLRFYLAPKFDEEE
Download sequence
Identical sequences A0A1E3P3G6
XP_019038649.1.93583 jgi|Wican1|69788|estExt_Genemark1.C_4_t20372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]