SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LH15050-PA from Linepithema humile v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LH15050-PA
Domain Number 1 Region: 210-277
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000837
Family HLH, helix-loop-helix DNA-binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 283-332
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000000405
Family Hairy Orange domain 0.00056
Further Details:      
 
Weak hits

Sequence:  LH15050-PA
Domain Number - Region: 45-126
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0228
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LH15050-PA
Sequence length 415
Comment augustus_masked-scf7180001004838-abinit-gene-14.40-mRNA-1 protein AED:0.0615082787167989 QI:0|1|0|1|1|1|3|0|415
Sequence
MWRVVVARSDDNSTLLSSEITSGAVAPGHLSTLSAPPSGHHWGYPPPPHHPPYQPPPPPP
QHPDMRHHHHDMRPPVSHELRHAAGDLRGPDLRHPEMQRHQELSRHDIARHQDVRHQDMP
VMRSDMPEMRSSHEFLELKIETELGSQDNAQQQQQQQQQQQQQQQSQQQTQQQSQQNQGH
QQRNLKRTMSDSDCDDVFSEESGKEPCNSPGGDSCQHASRKRRRGMIEKKRRDRINASLG
ELRRLVPAAARDPHSGKLEKAEILQLTVEHLRTLRNKGPEGYDSTKLAMDYHAVGWGECA
AEVGRYLVTMEGLDERDPLRLRLLSHLQSFHREHPPSAVLPSAVPSAPTTLTSTSTASSY
EPPPSSTVSAGMPPGAGSMPPLLGGGTLGWSQYPGQYPQQQHGKPYRPWGAELAY
Download sequence
Identical sequences XP_012217930.1.42766 LH15050-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]