SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LH16258-PA from Linepithema humile v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LH16258-PA
Domain Number 1 Region: 1-218
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.63e-63
Family BAR domain 0.000000632
Further Details:      
 
Domain Number 2 Region: 228-313
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-24
Family SH3-domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LH16258-PA
Sequence length 317
Comment genemark-scf7180001004905-abinit-gene-7.63-mRNA-1 protein AED:0.0939597315436241 QI:0|0.71|0.87|0.87|1|1|8|377|317
Sequence
MGGAEGTKLDVDFVDMERKTDVTCELVEELQLKTKEFLQPNPTARAKMAAVKGISKLSGQ
AKASTYPQPEGVLGDCMLTYGKKMGDDSIFAQALIEMGEAMRQMADVKYSLDDNIKQNFL
EPLHHLQTKDLKEVMHHRKKLQGRRLDFDCKRRRQAKDDEIRQAEEKFAESLHLAQMGMF
NLLENDVEQVAQLATFSEALLEYHQQCVEVLRGLTETLLEKLAAAFGSLAHSCRLFSASP
LPSPSKSPARTPITQPRTPCCTALYDFEPENPGELGFKENDTITLTQKIDDNWYEGSLDG
RTGYFPVSYVQVVVPLP
Download sequence
Identical sequences LH16258-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]