SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LH17360-PA from Linepithema humile v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LH17360-PA
Domain Number 1 Region: 70-110
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000124
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 108-148
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LH17360-PA
Sequence length 210
Comment maker-scf7180001004927-snap-gene-1.4-mRNA-1 protein AED:0.663199359881824 QI:0|0|0|0.25|1|1|4|0|210
Sequence
MAFMLNENENLFDLLNRLNECDQHFLFSSQLKIYKCGYIKVCAYYEKYVVTRLQYRIIDK
RHEIPAPVVMETPRCRADEFECASGSCVSKNARCDGRNDCVDHSDEYNCNVTTCSGDQFR
CLDGICLSIDKRCNGIPDCRNGEDESQCAVSRDKFAPMLFAKYWLLDTIIHERSRGALEL
KRASNAPVKFNNKIAGTLISLVDKFNNDLI
Download sequence
Identical sequences LH17360-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]