SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LH21003-PA from Linepithema humile v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LH21003-PA
Domain Number 1 Region: 206-255
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000105
Family Ovomucoid domain III-like 0.0057
Further Details:      
 
Domain Number 2 Region: 109-175
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000319
Family Ovomucoid domain III-like 0.0027
Further Details:      
 
Weak hits

Sequence:  LH21003-PA
Domain Number - Region: 41-70
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000116
Family TB module/8-cys domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LH21003-PA
Sequence length 357
Comment maker-scf7180001005004-snap-gene-1.18-mRNA-1 protein AED:0.172108618409989 QI:0|0.33|0.25|0.75|1|1|4|0|357
Sequence
MKRRFAMRRKDNHRIHHRLCYNYELVFKEFLLVVNANGGFSGICWSSISNGRCKELLSQG
VTREDCCASNAAAATAYSDEDLDSGSLFFWRVLGGGVQCRPCRESCAEVRCEEGKKCVVR
RGRPRCVCSPECKAPRGGGPVCGTDGKSYKSLCRLKKRACKKGSHELAVAYNGHCQSSCA
RVRCGQGRTCLLDQNLSPHCVRCARRCPQAPPHQVAGARPVCGADGNTYKSACHLRLAAC
RAGRAIPVAYKGHCKRESLFFFLLLAKSCSVSPFACNNFRKKSILRNKMLKSSERFIVRY
STTLYGINISITAKFLLYRGIKQEKEVVNRLCTHNLSKKMLNKVSAYKIVGYSDIGK
Download sequence
Identical sequences LH21003-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]