SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LH22530-PA from Linepithema humile v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LH22530-PA
Domain Number 1 Region: 99-158
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000196
Family HLH, helix-loop-helix DNA-binding domain 0.0021
Further Details:      
 
Domain Number 2 Region: 187-234
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000017
Family Hairy Orange domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LH22530-PA
Sequence length 462
Comment maker-scf7180001005021-snap-gene-4.9-mRNA-1 protein AED:0.0863581900880604 QI:0|0.33|0|1|0.33|0.25|4|0|462
Sequence
MVTHSMDNILNMQYYPTNSHVDASVHSPPPRKRRCLNKEVNIFPSLRNPRIRSVKFSGNL
SENCSGMLSKLICESLLARSYKLFENVKVIGLCLFLLQQDPMSHRIIEKRRRDRMNNCLA
DLSRLIPAEYLKKGRGRVEKTEIIEMAIRHMKHLQGLRQDTKHSPVTPVHTHPEDSVDSV
SHSAAASTAAEHYRLGFQECLSETMHFLVEVEGFFARDALCVQLINHLQQHCDKILATST
YYSTVKRISSFIIRIASRSDRLGFPHPELPATNGAMNGAGYAHTSISTICQPNGGHSDHG
SSSGVSSFGDPERPLLRPTIVPPPTIVSDDSNHSTHSHSTPPGTGTVSCRDRPTNYKFKS
SIKQRFSAERVKSCSPPISNGAGTDKPPSSSSHGVPIFALHDAGSFYVPLTVEASLIRPH
LSFIPDIGPDTVLHPVTISVNFKHSTPPAWTQQHSPTHQHQT
Download sequence
Identical sequences LH22530-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]