SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LH23271-PA from Linepithema humile v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LH23271-PA
Domain Number 1 Region: 494-880
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.03e-124
Family Oxysterol-binding protein 0.0000202
Further Details:      
 
Domain Number 2 Region: 140-263
Classification Level Classification E-value
Superfamily PH domain-like 1.98e-22
Family Pleckstrin-homology domain (PH domain) 0.00000273
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LH23271-PA
Sequence length 1017
Comment maker-scf7180001005056-snap-gene-1.45-mRNA-1 protein AED:0.0927612433132454 QI:0|0.81|0.70|0.94|1|1|17|0|1017
Sequence
MSSQPIVVPGGDHQRPPVETHSVGSSADSFKTMTPPNVSRSLSQPADRQPRRSSIQAQST
PLPKLPSTESLSTSINITAGAPPVSPGLSAMGETSQKVDNLSDKSLDSCKLTRKESYKAQ
RKNYRMEKKRVANELLSSFKDPTVIVMSDWLKVRGTLKSWTKLWCILKPGLLLLYKSPKT
KSNHWVGTVLLNTCQVIERPSKKDGFCFKLFHPLEQSIWAPRGPEKEAIGAVVQPLPTSY
LIFRAPSQAAGKCWLDALELSLRCSSLIVRSTSALPRPLPHDTTTTHETQWSEADYEKHF
DDHGPYVSPTTPQRRLLSCPQPLSPAITRNLKSVCPSPTPMFQQLYHAVAYWEKQLLERS
PTPGTDQENVAFSISNEEPNGGDNQPSGSSHSASAFHPPISPARRMTVPSVHVLEYDTRQ
VVTLDPVYTSHTDLDDISQPENGVAADVEISASDSESEASAKEDQSPEPITETPYVANEN
EFLGTAGEVVAELQEEQKSLIWFLMKQVRPGMDLSKVVLPTFILEPRSFLEKLADSYYHA
DLLSLAVLEDDAFTRMKAVVKWYLSGFYKKPQGLKKPYNPLLGETFRCYWQHPNGSRTFY
LAEQLSHHPPISGFYVTNRQDGFTISATIIAKSKFYGNSTSAVLDGVAILTMLPRGEDYT
MTIPYAHCKGILMGTLSMELGGKVNITCEKTGYHTELEFKLKPFLGGAELMNQVVGRIRL
GKETLATIIGYWDGLISIVDKRTGQENVFFNPTPEVRQKRLKKYTVPMECQGPWESEKLW
HAVTQAINRDDQTAATEAKTGLEEAQRERAKERKSLGQEWIPKYFVQDIITGNWVYRHAD
VRPWDPRNDVVQYEENYVVRTKTRHKTPIMRTGSIVSTEPQSQIPLLQAESRSSLSVLKS
SKRQLSNNMPLTETHDSGSSSAEAHTDSSQSIGKRRRSTARIIDIVKEVDNQMLHHGEKL
NRIQQIVEQIARKQRESGEQHHNINMSKSFIDTILIIIIVFFVQYFISVWKNNSAKD
Download sequence
Identical sequences LH23271-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]