SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CADANGAP00001757 from Aspergillus niger 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CADANGAP00001757
Domain Number 1 Region: 268-558
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 7.32e-67
Family Tyrosyl-DNA phosphodiesterase TDP1 0.0000284
Further Details:      
 
Domain Number 2 Region: 93-298
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.56e-58
Family Tyrosyl-DNA phosphodiesterase TDP1 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CADANGAP00001757
Sequence length 559
Comment pep:known chromosome:CADRE:IV:5322870:5324821:1 gene:CADANGAG00001810 transcript:CADANGAT00001810 description:"Putative uncharacterized protein An02g02970"
Sequence
MEEPDRPAKRAKLSSNIDNADNDSNQASNSSSIESNNHPLASLHRSITPPLLSRSKGPKT
PPQPQHNATHPASPSTQKTKKNNDREINKESIIPSPIQLTHIRDLPASSGHNTDTVRLRD
ILGDPLIRECWQFNYLFDVDFLMSQFDEDEACTRHPNVEAIVAYMPEAFGTHHSKMMILL
RHDDLAHEHRVVIHTANMIAGDWANMCQAVWRSPLLPLCSDGSGSENIATPGARFKRDLL
SYLREYGQRKTGPLVAQLEKHDFSAVRAALIASVPSKQKIRESTDSNQKTLWGWLALRDV
LRSVPVSPSEDRPHIVTQISSVASLGQTDKWLKDVFFASLSPSSNNPKPRFSIVFPTPDE
IRRSLNGYGSGGSIHMKLQSAAQQKQLQYMRPYLCHWAGDVAEDEVKMKREAGRRRAAPH
IKTYIRYSSSEMDRIDWAMVTSANLSTQAWGAAVNANGEVRICSWEIGVVVWPELIAGAG
AEGRSVMMPCFRRDMPDADAVAAADANANADKKEIPTTTTVGFRMPYDLPLTRYGETDIP
WCATASHSEPDWLGQTWEG
Download sequence
Identical sequences A2QCB7
5061.CADANGAP00001757 CADANGAP00001757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]