SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CADANGAP00005388 from Aspergillus niger 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CADANGAP00005388
Domain Number 1 Region: 27-227,275-311
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 6.08e-39
Family Phospholipase D 0.056
Further Details:      
 
Domain Number 2 Region: 337-585
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.48e-28
Family Nuclease 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CADANGAP00005388
Sequence length 817
Comment pep:known chromosome:CADRE:IV:443477:447454:-1 gene:CADANGAG00005496 transcript:CADANGAT00005496 description:"Putative uncharacterized protein An07g02240"
Sequence
MDKFKHKIENLEEQLKETHIEEKAFHLKHKVGKFFNIVNPNHRHDEAHEKATDAKRTAIS
ESHRFKSFAPIREGNKVKWYVDALDYMWAVSMALEEAKETIYIADWWLSPELFLRRPPFM
AQEWRLDQVLKRRAEAGVKIYVIVYKEVRSALTCNSAHTKHALRNLCPEGSPGYGNIRVL
RHPDHNIFENAADMTLYWAHHEKFIVIDYALAFIGGIDLCFGRWDAHQHPLADVHPSNLR
NEVFPGQEFNNNRIMDFQSVGDWQANELSKAEYGRMPWHDVAMGVMGDCVYDIAEHFVLR
WNFIKRDKYKRDNSVDWLMLEGRTGDDEDLVAQGFARAQIVRSSADWSSGILTEHSIQNA
YKEIISQAQHYVYIENQFFITATGDKQAPILNTIGQSIVEAVVRAGKEGRKFRVIIVIPA
IPGFAGDLRQNEATGTRAIMDYQYKSILRGEHSIFGQIAAQGVNPRAHTTMLNGGNMSDE
PWEGDPEAEKENFIQEELYVHGKVCIVDDRVVICGSANINDRSQLGYHDSELAIVVEDED
LIGSIMDGKPYKAARVAATLRRQLWREHLGLLPAQHYDASEDPNAKPPYMCMNHILEGPE
DDFVTDPMSDELWEMWTGRATVNTDMYRMLFRADPDDNIRTFDDYDKFCPRGNKQGHLFD
PYQPVEEIREKLDKIKGHLVWMPLEFLKDANMAEPGLAVNQITEVILPTSRYFAQLNPTS
RDPRIVGKVHTATPTSMSQVPSELDNISKVEEFLNSKVQGMFYPDTTPPSLSLSLPAHRP
ISQFVVSYLIAPFMYTILVITMKTNRSMWILTSYYLP
Download sequence
Identical sequences A2QMI7
CADANGAP00005388 5061.CADANGAP00005388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]