SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SI2.2.0_05936 from Solenopsis invicta v.2.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SI2.2.0_05936
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily PH domain-like 9.49e-42
Family Phosphotyrosine-binding domain (PTB) 0.0000145
Further Details:      
 
Domain Number 2 Region: 304-405
Classification Level Classification E-value
Superfamily SH2 domain 8.35e-28
Family SH2 domain 0.0000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SI2.2.0_05936
Sequence length 410
Comment locus=Si_gnF.scaffold01578[755266..759183].pep_2 quality=100.00
Sequence
TLQYIGCLEVYTSMKSLDFETRSCVAKECINRVCEAAGLKSADKKRRVDRKVLRAIADKP
RMEHSAASVTLTISSCSLSLTNIENGHIIAKHDMPRISFASGGDTEILDFVAYVAKNMQE
WRACYVLECTGGLAQDVISTIGQAFELRFKEFLTKPSSLHPVLNGVREMDRDYYNDLPGK
VPPDIGPPPVPPLPTTASTLPNLKHHQNASRTHAQNIAVDSFPSAADRHQQLAETGNLID
LNSDSTISPSTNLNIISEHNYVNDSIIAANRDNHRDPASLFDVFDMQPFSSAISDMNRLS
PRSQKQQLKQEIWFHGSVSRSEAESMLTRDGDFLVRESQGSPGQYVLTGMNNNTPKHLLL
IDPEGVVRTKDRVFDSVSHLVNHHCDNVLPIISADSVLVLRYPIPRHTNY
Download sequence
Identical sequences E9IG49
SI2.2.0_05936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]