SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SI2.2.0_09908 from Solenopsis invicta v.2.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SI2.2.0_09908
Domain Number 1 Region: 393-788
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 7.32e-120
Family Oxysterol-binding protein 0.0000284
Further Details:      
 
Domain Number 2 Region: 84-207
Classification Level Classification E-value
Superfamily PH domain-like 2.2e-22
Family Pleckstrin-homology domain (PH domain) 0.0000029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SI2.2.0_09908
Sequence length 933
Comment locus=Si_gnF.scaffold06343[1182289..1194709].pep_1 quality=100.00
Sequence
MSSQPIVVPGGEHQRLQPETQSVPVGSSTDNFKTMTPPNVSRSLSRKCSLDTSKLTRKES
YKAQRKNYRMEKKRVANELLSSFKDPTVIVMSDWLKVRGTLKSWTKLWCILKPGLLLLYK
SPKTKSNHWVGTVLLNTCQVIERPSKKDGFCFKVFHPLEQSIWAPRGPEKEAIGAVVQPL
PTSYLIFRAPSQAAGKCWLDALELSLRCSSLIVRSTSALPRPLPHDATTTHETQWSEADY
EKHFDDHVAYWEKFLLDRSPTPGIDQENVVSSIPNEEPDGDDDQPFGSSCSTSASHPSIF
PARRMTIPSVHVLEYDTRQVVTLDPVYTSHTDLDDISQPENGVAADAEISASDSESEASA
KEDQSSEPITETPYVSNENEVLGTAGEVVAELQEEQKSLIWFLMKQVRPGMDLSKVVLPT
FILESRSFLEKLADSYYHADLLSQAVLEDDAFTRMKAVVKWYLSGFYKKPQGLKKPYNPL
LGETFRCYWQHPNGSRTFYLAEQLSHHPPISGFYVTNRQDGFTISATIIAKSKFYVALLY
TCFAGNSTSAVLDGIAILTMLPRGEDYTMTIPYAHCKGILMGTLSMELGGKINIICEKTG
YHTELEFKLKPFLGGAELMNQVVGRIRLGKETLATISGYWDGLISITDKRTGQENVFFNP
TPEVRKKRLKKFTVPLEHQGAWESEKLWLAVTHAINRDDQVAATEAKTRLEEAQRERAKE
RKNLGQEWIPKYFVQDIITGNWVYRHADVRPWDPRNDVIQYEENYIVRTKTRHKTPIMRT
GSIVSTEPQSQINYLDKSLQIPLLQAESRSSLSVLKSSKRQLSNNMPLAETHDSGSSSAE
AHTDSSQSLGKRRRSTARLIDIMKGIEHQSIEHGEKLNRIQQIVEQVVRKQRESGEQHHN
INMFKSFVDTILIIVIVFSVQYFVNIWNSPTKG
Download sequence
Identical sequences E9J1N2
SI2.2.0_09908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]