SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SI2.2.0_10574 from Solenopsis invicta v.2.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SI2.2.0_10574
Domain Number 1 Region: 34-119
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 1.57e-25
Family Chemosensory protein Csp2 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SI2.2.0_10574
Sequence length 127
Comment locus=Si_gnF.scaffold02958[131636..133383].pep_2 quality=100.00
Sequence
SRVTVKIEETMARLSCIVTVIGIALMCVAAQDLYSDKFDHIDVASIVTNDKLRNEYYSCI
MDTSPCKTADAKFLKEIFAEALNNDCKKCTEKQKEHMKTIQDWYTTNKPDEWQAAVAKAE
DLKKNAR
Download sequence
Identical sequences E9IN82
SI2.2.0_10574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]