SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SI2.2.0_13854 from Solenopsis invicta v.2.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SI2.2.0_13854
Domain Number 1 Region: 196-297
Classification Level Classification E-value
Superfamily PH domain-like 7.07e-24
Family Third domain of FERM 0.0046
Further Details:      
 
Domain Number 2 Region: 100-198
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-23
Family Second domain of FERM 0.0011
Further Details:      
 
Domain Number 3 Region: 20-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.93e-16
Family First domain of FERM 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SI2.2.0_13854
Sequence length 323
Comment locus=Si_gnF.scaffold06255[3691..6380].pep_2 quality=100.00 tag=gw_corrected
Sequence
MPFKFHLKKSRQYNVVSKNQYVICVELLDATSIECTLSIDSVGQECLDNVTQRLGLGQPE
FFSLRYICRGTSSLRWIDMDKPLKRQLEKDAKSFTLYLRVIYHYYLQLKNDVLENKIQCN
YRQACILASYSMQAEFGNYSLERHTIEYLQQCTFFPNVKCGQESLLHTAICQYKSLGNMT
QTTAEELYISIAIQLEGYGTETFTAKDNSNNKVVLGISINGIMVAYPNMQTTQFYRWKDI
SNVINQKKTFRIEYKMEEAKQFVFTESRDAKYIWRLCIAQHLFYIQYQERRPQERSSGCC
VRKLALIXVSKTRAYTEVYIITD
Download sequence
Identical sequences SI2.2.0_13854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]