SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SI2.2.0_15792 from Solenopsis invicta v.2.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SI2.2.0_15792
Domain Number 1 Region: 216-247
Classification Level Classification E-value
Superfamily WW domain 0.0000000786
Family WW domain 0.0018
Further Details:      
 
Domain Number 2 Region: 13-61
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000952
Family HkH motif-containing C2H2 finger 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SI2.2.0_15792
Sequence length 419
Comment locus=Si_gnF.scaffold04719[36386..39922].pep_1 quality=94.51
Sequence
MDCRADYWKSQGRKFCDFCKCWIADNKPSIDFHEGGKKHKENVSKRLKEIHKNSAKQAKQ
NKKFEDDIKKMENVCIHKYWLRCEGTNSEQIISFVQAAMAAYLRDVENNTRDMTAQKIMK
EKLNRVETKETPQNCNRMPSAAPETVPRFKSNNEQFSPKVDPCDPTTLPKGVPSFPRVQQ
HGGENRTQGKSKANKGKGKGKKTQEDDRPTAAVRKLWYEARSPEGYTYYWHIETNESVWE
PPEEGYMTFAEQEEEAKEETLQRELMEQLDKEEVSEKTDILEEQRANVEREKMKEFRKRP
VENDAQGDDKSVEIKNVAAEEERPYWRDYSVPERPQPYGSWQVVDTSKKKPIDLQLPKQQ
KQIQLPTFTKFEPPPLQRTFKEKTVTQISTGDSDDEEASTIFKKRKISNKSVRKRTTDD
Download sequence
Identical sequences E9IUU0
SI2.2.0_15792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]