SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Cocvi1|26106|gm1.4710_g from Cochliobolus victoriae FI3 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Cocvi1|26106|gm1.4710_g
Domain Number 1 Region: 21-277
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.35e-48
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.0000912
Further Details:      
 
Domain Number 2 Region: 369-545
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.57e-35
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.0000369
Further Details:      
 
Domain Number 3 Region: 283-361
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000155
Family Rhamnogalacturonase B, RhgB, middle domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Cocvi1|26106|gm1.4710_g
Sequence length 547
Sequence
MRCLAALTTLLLAPTAVFAAWGWTDDGKNYVIDTNANLVVKVSKSNADMTSIKYRGVEYN
GQNGKNSHVESGLAPGTVTIKQYTSPANIIKVTMKVGTLTHTLVFRYGNPNVYIFMNKRD
TSITVSRYIVRIPANIFTNNVNEDTDWIPNGAPAIESGDINGVNGQTWSKHYSGKKYGRT
IDYDYVGYTNNNVGMYLIRSNHEKASGGPFFRSLIRRGGDGGPDLYDIYQYNMGHTDPMR
LGLQGPSVLHFTDSGAAPNHNLFARNANWDWFDSLEIEDWVPASRRGAVAGVGLANMKSG
FQYVVGLKNDQAQYWTIATGAWRISNALPGTYTLTVYKGELEVHTSTVTISPGSTATRNT
ITLVDPNDTPAIWRIGDWDGTPRGLLNFQDTPMKPTYMHPSDSRLAKWDAGNFIIGTTPI
SGFPAYIWKDINNDHLVYFRLTDAQLARGAKIRIGVTQGQAGGRPTVAVNAWVAKLPADK
GQGDTRSLTVGTYRGNNYVYEFEVPASAWVASAREYQILKITVISGKTAAGYLSPAVSFD
AVELIGL
Download sequence
Identical sequences W7EUK1
jgi|Cocvi1|26106|gm1.4710_g XP_014557271.1.39273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]