SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Cocvi1|99409|e_gw1.43.117.1 from Cochliobolus victoriae FI3 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Cocvi1|99409|e_gw1.43.117.1
Domain Number 1 Region: 413-574
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.42e-23
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.014
Further Details:      
 
Domain Number 2 Region: 303-402
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000000647
Family Rhamnogalacturonase B, RhgB, middle domain 0.034
Further Details:      
 
Domain Number 3 Region: 112-299
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0000179
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Cocvi1|99409|e_gw1.43.117.1
Sequence length 576
Sequence
MKALLPLLCGGAGIVASAYSQHPSAPEQPKSFFRQIGNSTWILGNELWNLTQNAQYATKL
MYRGKDRVGEAVGHYVSYNGAASDLRWTTASIAASGSNWLDIRFSAAEGDFHWVLHDDLA
GAYQYFINRGLPTLGEFRSLWRLSNTSFPRASTNTKTGLLPPLSLYQNATNVQDETWQQS
DGTFLTKYDWAAFLREQTAYGVWGDEVGSWYLHAGKEYLNGDHLKQELMVHRESKTGDTV
QLNMLHGTHYQASSRDSFAAGNDEARIWGPWLWYLNDGSRQDAVERWEREEKEWPYAWFE
NAAYQSRGAVQGKLVLSDGRPAAGAAVFLGDNRNETVSTLDQGQNYYYTAYADDAGEFRI
RDVRSGTYALYAWGNGRSIADVITNFTHNDVEIVKGKTTSLPLLTWSVTDKTKRIFQIGD
FDRKTDGFYLADPAIPVQHARIDKCPANLTYIIGTSTPSKDWCFGQSKVGTWSVSFPASL
DNSTAAKLVVSLAGFSQGSSADILLNEAKIGNVTSASLANSQDTYRGATRAGEWRRLEFG
VPRGLLKEGQNRLDVRVTKSTQWRGWLWDSLVLEAV
Download sequence
Identical sequences W7ESH0
XP_014556539.1.39273 jgi|Cocvi1|99409|e_gw1.43.117.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]