SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Cocvi1|102423|e_gw1.55.55.1 from Cochliobolus victoriae FI3 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Cocvi1|102423|e_gw1.55.55.1
Domain Number 1 Region: 1249-1347
Classification Level Classification E-value
Superfamily PH domain-like 0.00000135
Family Ran-binding domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Cocvi1|102423|e_gw1.55.55.1
Sequence length 1351
Sequence
MSTNKRGNIFGQGKPERPYEERDEPADVPQRATAAQLAARKIKTAKARRPAGASSGLSQS
ANFGAPQQNGFNFGASAPAPANGGANAFGGFGGNNAFGGASATSSFPPAQPAAPSTTFSS
SSFPAFGGSNSGTGTGFNPQPPSSAGFNFTAGGSNPFATANSAPATNGSTPAPAPAFGGS
IFGNSQAQSNPFGGLAQSSTSSAAPSTSIFGTSSAAPSGGMFGTSSAAPSGGLFGTTSGA
ANAPTTTAPASTPFTFGATSSSAQNTTSTPATSGIFSGFSNSTQTAPPAQNSIFSGFGAN
AQKEEAPKEPAASQTSMFGGFGSNAQKTDTATEAPKQNNIFGGLNTGAQSTPTTSSAPST
GLFGASTSATPIAKASTPADNPFANLPTAAGASTPFPGFEATSQTPQAQEKTPAPAANLF
GNLKKPEESTTTAAPETPKSNPFASLAKPATPPAAAPAATSSGFSLFGTDKDKDSSSATL
KAPEAPKSSLFQPFSTPQPAKTADTETSQGGLFSAVQPKTSSGLFSQTFQSEVNKSSNLF
SKPQSSFPSFTPSATSSTEAPKAPAAASPSEKSNPFASLSTPSTDRPNLFSTPKEPAQAS
PAPAMPNLTGSSILSNESQQTPEMPKVPKVHVPKEWSVPGVVRAQSGDSLLKQITDLTAQ
LQVLNGKYRQQISTLPPTADWSSVSLWHYQHSTDIKKKIDNAKKQRAASRGVTGTESSLS
TKRKADEDTVEARDPSPIKRSRPAETPSSPTPQPSASTPKLNPPATATSNMFAKAIGNKP
STPSTSSTSSTNLFAPKTAEKSSEEPAKANAPVTSFGFTPSLPATNGTSNSSTSSGFKPT
FGGTPSSTSGSTGFKPNFGSTSGGGGGFMAQFTKTAKTYDELAAERKKKAMEEDYDSDEE
TEEQWSARYDKAEEERRAEEKKKAAATPTFTFGASAKPDAQPSGSTPKSNPFSGLLKPTS
GTSTSGGFTPKDVSPAPSTGSQSVFNAPAASPAPSSNIFGHLSSGPSSNNQDESDEDDAE
QQEIAGSVEPATPRVNFGESEAESDGAQEQKQPNTSTKGSLLARITRDNDSESEKENNGI
SSTAATNGTTTPTNKPFQFFDFNAASKTAPPKSDTFAGDQTFKFGSPIKFGQAPATEKKD
APKFQFQPATPSPGEGSTTPAKPPPSSIFNFASSTGGSSLFAPSGGNSIGSSVFSSRAGT
PLSEAGEVSAASAAEDEDGEKHEQIDLSQLTEEELNTYDIVFHTDVVLAKHQVDKDGEKA
WVNLAKGPLWILKDKETAKCSVRVRIPSGATPLNYQILPSLPATVTGSSKKMVMATKPAK
EGGLQSVIFAVKSPEIAVEMAAKYTESVPSP
Download sequence
Identical sequences W7EJC4
jgi|Cocvi1|102423|e_gw1.55.55.1 XP_014555480.1.39273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]