SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Cocvi1|25276|gm1.3880_g from Cochliobolus victoriae FI3 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Cocvi1|25276|gm1.3880_g
Domain Number 1 Region: 942-1011,1084-1127
Classification Level Classification E-value
Superfamily PH domain-like 0.0000101
Family Pleckstrin-homology domain (PH domain) 0.045
Further Details:      
 
Weak hits

Sequence:  jgi|Cocvi1|25276|gm1.3880_g
Domain Number - Region: 672-724,821-885
Classification Level Classification E-value
Superfamily PH domain-like 0.000563
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Cocvi1|25276|gm1.3880_g
Sequence length 1137
Sequence
MPTQERHSWHKPEVTNLPPDSYTAQRLQHATPEHLHLTSRRYFIGPIPTAWLNKHRRDWY
KHHLRINYSTRAGTFSSDPHDARQRRLSGLEGPSSSALFQHSFPQPQELDAEEEETGDRE
GGQKGDLQSSEASGANGKAAATAASPPALQIPRSSDNRKDVVTEAEEEHWVDAPSEPEDE
DGDSDDDDTHHDHNQDIPAPPLTTRRSSEKTFVTASSVPITEPDNSEITEDQDPQQEEQH
PVEQNGLQVPSNGSEPGSKSLGKRPLLSIESHGHPASTTGAASVDANSTSSLLPNADTNK
APALADIDPNPPAKGILAKVRRKSEMMSSSSGQAQDVDASSGELTRKKSTMRNLVKFDVP
ENSRRAAIHLKAKKAQMTVQRAGTRVRRKNIKEGLVVKMERMLVRVDAAAEVPEDFDENV
SQRVVSRVKNKWREYMVVCRHSHVDGADFVLQFYQTRVIPEIENAGASKKAAYEIPLSRK
TSKANLYSALDKTVVVSTPRRPETLIFIMQARTSSSAAEWYTFIRNILGWQRASELQINI
PDMSLSVSIVNPFAQLESSQNKVHCADDTEEALLKTMQEEEAVAENLIRRCLEQLEDEPQ
WADVLASWMKDQRIGLAWKRYDRLEWIHGANERKMYGTIAMLKSHELELRPKTHYPTTAI
TRKKHKTLTEPVPVEGFLIRLTGQRGRSKRLGLMYHKQLYFASHDQYLVFSRPTKATPPP
PPKLPASENAAVPTPDAVRDAVPDSWAVNPYSLQHGQIEWLMEGHSGTTEARRLRDEDAA
DEAERKEQNLLNCDGYINLTDVVKVRKARLGASAADEDLEEGSDVDFDEDIDDSMNNDGV
TNDLDLDRTLELVMKNGLIIRLQAANKARRKEWIQHLRALVKYWKHRTASDIALYKSTRS
RNLSALKIDEETEAHVGQFARKWEVTQSFASPELYNMCGIACCRPIHMSGMLYRKPRIHA
PFTRCSVLLTAGTLLIFRDVLRSRSGKQLAHIHHERMANLDLKDCYIYSGLLTENDLLYQ
NQTFDANKPGHHALPRIYLEDGWTSTDEDVMTTFVIWHGKAKSWFRAEEGAGGGEQNRKE
GKRTKLKRVAKLGSKGRSVVFRARSRAERDHWVLAIQNEIERVQGSAADFRLEESIQ
Download sequence
Identical sequences W7EKP5
jgi|Cocvi1|25276|gm1.3880_g XP_014558168.1.39273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]