SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Cocvi1|35671|fgenesh1_pm.21_#_95 from Cochliobolus victoriae FI3 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Cocvi1|35671|fgenesh1_pm.21_#_95
Domain Number 1 Region: 434-563
Classification Level Classification E-value
Superfamily PH domain-like 4.1e-24
Family Ran-binding domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Cocvi1|35671|fgenesh1_pm.21_#_95
Sequence length 566
Sequence
MADTPETQHEAAAAVTPAPATKDITGTAPTSPARSDKSSDSEGKNVREKLKDTQINAPPT
SNPVSDTDQATKDATNGITKPGDQSVSGSDSERGRLRRKRSREDFEDDVDADKQPEKKIE
RHARKRSRDITKDLEAGIPAKPAGNAISSIKESDTDEHMTSPSKSASTTTATATTEKRSG
SNTSPKNKRSREEAENDTEDTTKGTEIGAANGDTALSEERDSKRLRDKERTQSITDTESK
TKIPPGSGFANTSASSPFAAMAAKPQQAKTSDKPDSLPQTSDDKFKASGFGGFAASTTSP
FGGLGGLGGSKPSTSSPFGAASGNKLSSFAGSAAPSTLGGGGGFGALGGSGTSSFGGSSF
GGSLGGGFGGLGGVKTIGSFAAPGGNLEIKGLKEKEKPFGAAADDESSEDEDGDDEDPEK
GTEKEERQRQSSQPLLSQHPPETGEEGEQTIWTGRAKLYLMAGEGSNRAWKERGVGTFKF
NITVDEPKKARFVLRAEGTHRLLLNAAVTRKMVFGGDAQGEKPKDGRLLFNSPNQDGELE
MHLLRMKAENAKQLWEEVTKVQEEQL
Download sequence
Identical sequences W7EG30
jgi|Cocvi1|35671|fgenesh1_pm.21_#_95 XP_014559129.1.39273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]