SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|73748469|ref|YP_307708.1| from Dehalococcoides sp. CBDB1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73748469|ref|YP_307708.1|
Domain Number 1 Region: 34-289
Classification Level Classification E-value
Superfamily "Helical backbone" metal receptor 2.7e-77
Family TroA-like 0.00000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|73748469|ref|YP_307708.1|
Sequence length 290
Comment cation ABC transporter periplasmc-binding protein [Dehalococcoides sp. CBDB1]
Sequence
MKFRTLFLSLILGVTLLSSLLLAGCQEETPSTAKLKIAVSIVPLKEFTQQIAGDKAEVVL
MVPPGAEPHTYQPLPSQMVDVSQADMYVKLGSDFGFEQNWLSKILSLNHSMLVVDSSVNI
TLESSLEDSGADPHIWLSPRNAIQMVKNITLGLMSLDPENQSYYAANRDAYLAKLEQLDN
EITLAFSNLYNRTFLVFHPAWVYFARDYNLKELSIEIEGKEPTPQQMIEIINMAIQNNIS
IVFASPQFSSRSAEAIASEIDGRVVMIDPLAEDYITNMEFVYKQMQEVMS
Download sequence
Identical sequences A0A142VAP0
gi|73748469|ref|YP_307708.1| gi|452203473|ref|YP_007483606.1| 255470.cbdb_A618 WP_011309143.1.17753 WP_011309143.1.74482 WP_011309143.1.75083 WP_011309143.1.79047 WP_011309143.1.84634 WP_011309143.1.89941 WP_011309143.1.91135 WP_011309143.1.92458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]