SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|119714217|ref|YP_919359.1| from Nocardioides sp. JS614

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119714217|ref|YP_919359.1|
Domain Number 1 Region: 12-269
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.18e-52
Family Haloperoxidase 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119714217|ref|YP_919359.1|
Sequence length 277
Comment alpha/beta hydrolase fold [Nocardioides sp. JS614]
Sequence
MSTSSVASGVYHAQINGVRIAYQAVGRGEPLVLVHGSWGSHHNWDPVVPGLSARHRVVSY
DRRGHSESERPAGQGTFAEDVADLAALVETLDVAPAWVVGNSVGAVITLQLAAARPDLLR
GVIVHEPPLRGPLSEGGADEALRMVLELIRAGDHAGAAERFVDDVAFGRGAWARLPERMR
ATMVDNAPTYLDEELAPDSRTVDEVALARYRGPVLVTSGGQSPPIFQPVLRHLARLLPQG
HRLQYAGAGHIPHATHPEEFVSTVLGFVSDPGLGGAS
Download sequence
Identical sequences A1SCG1
196162.Noca_4916 gi|119714217|ref|YP_919359.1|NC_008697 gi|119714217|ref|YP_919359.1| WP_011751621.1.100580 WP_011751621.1.96005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]