SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|241203651|ref|YP_002974747.1| from Rhizobium leguminosarum bv. trifolii WSM1325

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|241203651|ref|YP_002974747.1|
Domain Number 1 Region: 24-265
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.16e-58
Family Haloperoxidase 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|241203651|ref|YP_002974747.1|
Sequence length 276
Comment alpha/beta hydrolase [Rhizobium leguminosarum bv. trifolii WSM1325]
Sequence
MEVDDDELIHFEAHGAAPLPPAAVDGHVAHDGARIWYASYGAGPPVILLHGGLGHSGNWG
YQVPALLRRGRRVVLVDSRGHGRSTRDSRPYSYELMAADVLAVMDELHLDKAAIIGWSDG
ACIALILAMTAPSRVEGVFFFACNMDPSGTREFVPTPVIDRCFGRHAKDYGALSTTPDDF
NPFVEAVSLMMRTEPNYQASDLGLIRVPVAIVLGEHDEFIKLDHAEYLARSIPNAEMIYL
TGVSHFAPLQRPGEFNVAVVNFLDDIGTRKNEDLRR
Download sequence
Identical sequences C6AS33
gi|241203651|ref|YP_002974747.1| 395491.Rleg_0911 WP_012756569.1.14669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]