SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|241204853|ref|YP_002975949.1| from Rhizobium leguminosarum bv. trifolii WSM1325

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|241204853|ref|YP_002975949.1|
Domain Number 1 Region: 8-178
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.07e-33
Family YdeN-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|241204853|ref|YP_002975949.1|
Sequence length 184
Comment hypothetical protein Rleg_2133 [Rhizobium leguminosarum bv. trifolii WSM1325]
Sequence
MKASDADILIIPGYTNSGPSHWQSRWEAKLSTARRVEQAEWTKPVREDWIARIAEEVNAS
TRPVVLVAHSLGVPSVIHAIPHFRNRVAGAFLVAPPDVANPDIRPKHLMTFGPYPRDPLP
FPSITVASRNDPFGSYEHADDVASSWGSFLVDAGESGHINADSGHGPWPEGTMVFAQFLG
RLSP
Download sequence
Identical sequences C6AZK6
WP_012757624.1.14669 WP_012757624.1.67177 395491.Rleg_2133 gi|241204853|ref|YP_002975949.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]