SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220919993|ref|YP_002495296.1| from Methylobacterium nodulans ORS 2060

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220919993|ref|YP_002495296.1|
Domain Number 1 Region: 23-152
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000000000986
Family Acylamino-acid-releasing enzyme, C-terminal donain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220919993|ref|YP_002495296.1|
Sequence length 260
Comment putative dienelactone hydrolase [Methylobacterium nodulans ORS 2060]
Sequence
MPTLPDFTTFAFTHAGRERTIYRKGEGPPVLIMHEVPGISAEVVRFARRVVDAGFTVFMP
RLFGPVGVKTTPVNRVAELLRICISREFQVLAENRSSPIADWLRALARHIHDEMDGRGIG
VVGMCVTGNFALTLTLDPWVLAPVMGHPSLPLPITRAKAAAVHVTPETFANARRRTTEEG
LKVLGVRFHGDMLFCRAARFETLRRELGDGFEGIELPAASAKPQFEPPHSVLTIGLIDRE
GEPTHEAVERVLRFLSERLH
Download sequence
Identical sequences B8IWL4
gi|220919993|ref|YP_002495296.1| 460265.Mnod_8749 WP_015934333.1.92880 gi|220919993|ref|YP_002495296.1|NC_011892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]