SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|262200179|ref|YP_003271387.1| from Gordonia bronchialis DSM 43247

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262200179|ref|YP_003271387.1|
Domain Number 1 Region: 13-272
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.49e-57
Family Epoxide hydrolase 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|262200179|ref|YP_003271387.1|
Sequence length 281
Comment alpha/beta hydrolase [Gordonia bronchialis DSM 43247]
Sequence
MTERITEYRRGPWTFDVIDEGPADGDPVILLHGFPQRASNWDRVARLLHERGLRTIAPDQ
RGYSPRARPRRRRDYRQSELVADVVALIDELGAPRVDVVGHDWGAAVAWTLAANHPGRVR
TLTAISVPHPGAFLRAMPRAQILRSWYMLVFQLPWLPEKLLGAGMRRPGFAVRMGLPADH
DDRLADIVDSGALNGALNWYRGMPIPDPAVRMRKVTVPTTYVWSDGDPALGRAGARLCAS
WVDAPYEFEALTGANHWLPENRPREVAEAILGRVLSVDDAG
Download sequence
Identical sequences D0LB63
526226.Gbro_0146 gi|262200179|ref|YP_003271387.1| WP_012832086.1.40537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]