SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|262201485|ref|YP_003272693.1| from Gordonia bronchialis DSM 43247

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262201485|ref|YP_003272693.1|
Domain Number 1 Region: 7-234
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.74e-33
Family Hypothetical protein VC1974 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|262201485|ref|YP_003272693.1|
Sequence length 245
Comment alpha/beta hydrolase [Gordonia bronchialis DSM 43247]
Sequence
MTHSSDADTPVVLVHGIRVSGASLHRIADAVTDRPAIHPDLPGHGARQGERFTMAAAVDT
IVGEIERAGRPAIVCGMSMGGYVAMAVAGRHPDLVAGVMPMCATTQPGRTFALPFQMLGA
ATAFLPKEAAVLSRILTRATVGRRVSDDMEVGGLALAAIADVVADVRGFDALGELARYPG
PIEFVNGGRDPFRAHERRFLAVSENAHLTVLPGASHLFPLIQPVRTGRLISEFAATCDAL
PRPAA
Download sequence
Identical sequences D0L715
gi|262201485|ref|YP_003272693.1| 526226.Gbro_1525 WP_012833368.1.40537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]