SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|262203050|ref|YP_003274258.1| from Gordonia bronchialis DSM 43247

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262203050|ref|YP_003274258.1|
Domain Number 1 Region: 6-253
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.75e-36
Family Acylamino-acid-releasing enzyme, C-terminal donain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|262203050|ref|YP_003274258.1|
Sequence length 261
Comment hypothetical protein Gbro_3160 [Gordonia bronchialis DSM 43247]
Sequence
MKRCPVHRTKIEYGSAPSQYGHLYHAADPADLPAVVRPVVLIHGGYWTTEFGLTIESAIA
RRYAERGALVWNIEYRRIGEPGGGWPNSLTDVVAALTALDEQARNALPDEVARVVDWSSV
GVVGHSAGGQLAVAAVARLGARTAKTRITTVVAQSAALDLVGAGKAGRPSVRAFLGADYA
DAPQRYRDASPLEAPVFDAHVVAVHGDKDTAIPVAVSRDYVEAVTARGQSAELIVVPEEG
HDVFVDPRSVGNRQTMRVLGI
Download sequence
Identical sequences D0LBX8
gi|262203050|ref|YP_003274258.1| 526226.Gbro_3160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]