SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|190890031|ref|YP_001976573.1| from Rhizobium etli CIAT 652

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|190890031|ref|YP_001976573.1|
Domain Number 1 Region: 2-131
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 3.62e-30
Family Antibiotic resistance proteins 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|190890031|ref|YP_001976573.1|
Sequence length 141
Comment glyoxalase [Rhizobium etli CIAT 652]
Sequence
MNPMLEGMLETALYARDLDKAEVFYEDVLGLEKISRAGNRHVFFRCGPGVLLIFNPEETV
KPPAPNALQVPPHGTSGEGHACFRVSGRNIDAMAERLKAAGVSIESEVHWPNGGRSIYFR
DPEGNSLECAEAKIWGIEQDI
Download sequence
Identical sequences A0A192T6F0 B3PZA1
gi|190890031|ref|YP_001976573.1| 491916.RHECIAT_CH0000401 WP_010024265.1.25642 WP_010024265.1.26360 WP_010024265.1.84722 WP_010024265.1.88425 WP_010024265.1.9020 WP_010024265.1.96076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]