SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|190890171|ref|YP_001976713.1| from Rhizobium etli CIAT 652

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|190890171|ref|YP_001976713.1|
Domain Number 1 Region: 64-168
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.32e-17
Family Antibiotic resistance proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|190890171|ref|YP_001976713.1|
Sequence length 169
Comment glyoxalase [Rhizobium etli CIAT 652]
Sequence
MAKTLRQALADRDISLTHSETLEIVARQFGLDQWNILSAKIEAAGASRSAVGIEPPTPIF
RIFSVEKAMEFYCGFLGFHLDWEHRFDENSPLYCQVSRDGMALHLSEHSGDASPGAKAFV
RVANVRAYHAELAGKDYRYMKPGVEEAPWGLEMTVIDPFSNRIAFCEQR
Download sequence
Identical sequences B3Q0A3
gi|190890171|ref|YP_001976713.1| 491916.RHECIAT_CH0000542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]