SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|190890936|ref|YP_001977478.1| from Rhizobium etli CIAT 652

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|190890936|ref|YP_001977478.1|
Domain Number 1 Region: 38-203
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.2e-35
Family Antibiotic resistance proteins 0.044
Further Details:      
 
Domain Number 2 Region: 203-315
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 2.82e-22
Family Antibiotic resistance proteins 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|190890936|ref|YP_001977478.1|
Sequence length 317
Comment glyoxylase [Rhizobium etli CIAT 652]
Sequence
MNRRNFLGLATGGMVAATAGAPIASEAGELSMTTETSYALTRPAYIDQSHLVVKDLGLVS
GFYQSMLGLKVIEKSASGEVLGVGGLPLLTLTTAGNAAIAPRNAAGLFHTAFLMPDRTEL
ARWLRHAAHHNVVLDGASDHLVSEAIYLSDPEGNGIEIYADRPHQQWKFHQDGMIEMATL
RLDLQALYDSAPDERWDGMAAGTAIGHLHLQVGDIPQADAFYRDVLGLTLMARYPGASFF
ATGGYHHHLAANIWNSRGAVARADNMTGLSDYKIRFNEKATLDAAVSKLDALEINSEKRD
GGVFLRDPWGIGLTLLA
Download sequence
Identical sequences B3PTZ6
gi|190890936|ref|YP_001977478.1| 491916.RHECIAT_CH0001319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]