SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|190890982|ref|YP_001977524.1| from Rhizobium etli CIAT 652

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|190890982|ref|YP_001977524.1|
Domain Number 1 Region: 2-123
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 7.43e-26
Family Glyoxalase I (lactoylglutathione lyase) 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|190890982|ref|YP_001977524.1|
Sequence length 126
Comment lactoylglutathione lyase [Rhizobium etli CIAT 652]
Sequence
MFDHISIGVKDLERARRFYDAALAPLGYERLSNSDRVIGYGPDEVGLWVIQAEHPVVADM
QSGLHFCFVAPDEAAVDAFHAAAIASGGTDNGEPGIRPDYGRFYYAAFVIDPDGYRLEAY
FHKGEI
Download sequence
Identical sequences A0A192T785 B3PU42
491916.RHECIAT_CH0001366 WP_012483190.1.19349 WP_012483190.1.25642 WP_012483190.1.26360 WP_012483190.1.76514 WP_012483190.1.81019 WP_012483190.1.82165 WP_012483190.1.84722 WP_012483190.1.88425 WP_012483190.1.9020 WP_012483190.1.96076 gi|190890982|ref|YP_001977524.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]