SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|528829343|ref|YP_008365299.1| from Rhizobium etli bv. mimosae str. Mim1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|528829343|ref|YP_008365299.1|
Domain Number 1 Region: 1-277
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.43e-64
Family Haloperoxidase 0.0000000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|528829343|ref|YP_008365299.1|
Sequence length 278
Comment non-heme chloroperoxidase [Rhizobium etli bv. mimosae str. Mim1]
Sequence
MSTVTTKDGVEIFYKDWGPKTAQPIMFHHGWPLCSDDWDAQMLFFLDKGYRVVAHDRRGH
GRSTQVADGHDMDHYAADAAAVVEHLDLRNTVHVGHSTGGGEATHYVARHGQPQGRVAKL
VIIGAVPPIMVKTDANPGGLPIEVFDDLRRQLAANRAQFYHDLPAGPFYSFNRPGAKVSE
PVINNWWRQGMIGGAKAHYDGIKAFSETDFTEDLKIITVPTLVMHGDDDQIVPIADSALL
SSKLLQNATLKVYEKFPHGMCTTHADIINPDILAFIKG
Download sequence
Identical sequences Q2K741 S5RY46
gi|86358180|ref|YP_470072.1| gi|528829343|ref|YP_008365299.1| WP_011425823.1.62937 WP_011425823.1.76939 WP_011425823.1.93170 347834.RHE_CH02571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]