SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|528831023|ref|YP_008366978.1| from Rhizobium etli bv. mimosae str. Mim1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|528831023|ref|YP_008366978.1|
Domain Number 1 Region: 12-296
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.15e-53
Family Proline iminopeptidase-like 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|528831023|ref|YP_008366978.1|
Sequence length 300
Comment L-amino acid amidase [Rhizobium etli bv. mimosae str. Mim1]
Sequence
MTEVATSEAYLPFRDYRTWYRVTGSLDSDKLPLVVAHGGPGCTHDYVDSFRDIAALDGRA
VIHYDQLGNGNSTRLPDRGPDFWTVDLFLEELSALLAHLGIEHRYAFLGQSWGGMLGAEH
AVRRPRGLKALVIANSPANMHTWVAEANRLRQELPKEVQDTLLKHEEAGSLTHPDYIAAS
RAFYDRHVCRVAPWPPEVARTFAIMDEDNTVYRNMNGPTEFHVIGTMKDWTIEDRLDRIE
APTLLISGKYDEATPLVVRPYLERVPRCEWVLFEHSSHMPHVEEKQLCLTTVSGFLSRCD
Download sequence
Identical sequences S5SQR4
gi|528831023|ref|YP_008366978.1|NC_021906 gi|528831023|ref|YP_008366978.1| WP_020922707.1.76939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]