SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|528838061|ref|YP_008369141.1| from Rhizobium etli bv. mimosae str. Mim1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|528838061|ref|YP_008369141.1|
Domain Number 1 Region: 21-254
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.16e-37
Family Carboxylesterase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|528838061|ref|YP_008369141.1|
Sequence length 282
Comment alpha/beta hydrolase family protein [Rhizobium etli bv. mimosae str. Mim1]
Sequence
MAVDPFRTRDHVTDFDEIVDDIRARSLATRRTVTMESNIAYGTGPDETLDIFLPSNAGSD
MPIHMFVHGGYWRMFSKEDYSCVAETITGVGAVAAIVDYSLMPAVRMDVLVGQVLKAKAF
LLAHANRFGATRKQFSVSGHSAGAHLATFLFHRSPAPSGVVAAFLLGGLYDLEPLQTSFL
REEIALSDEEVLRFTPMRHEHDPATRVAIMTGELETDPFRRQANAFRKILAAQGLEVRES
LVADGNHMSTVRDLAVAGTPVAAALRAAIVDAGARSERSAYP
Download sequence
Identical sequences S5SWG2
WP_020919570.1.76939 gi|528838061|ref|YP_008369141.1| gi|528838061|ref|YP_008369141.1|NC_021911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]