SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000006574 from Ficedula albicollis 76_1.0

(show help)
Strong hits

Sequence:	ENSFALP00000006574
Domain Number 1	Region: 112-142
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00000000000000301
Family	LIM domain	0.00077
Further Details:

Domain Number 2	Region: 46-78
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00000000000523
Family	LIM domain	0.001
Further Details:

Domain Number 3	Region: 81-111
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00000000000606
Family	LIM domain	0.0013
Further Details:

Domain Number 4	Region: 16-46
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00000000211
Family	LIM domain	0.0012
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

External link(s)	Protein: ENSFALP00000006574 Gene: ENSFALG00000006303 Transcript: ENSFALT00000006603
Sequence length	163
Comment	pep:known_by_projection scaffold:FicAlb_1.4:JH603224.1:5871360:5885330:1 gene:ENSFALG00000006303 transcript:ENSFALT00000006603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	GGGGGAQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGT SCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRL VPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC
Download sequence
Identical sequences	U3JUX0 ENSFALP00000006574

SEARCH