SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Ficedula albicollis 76_1.0 > ENSFALP00000010731

Domain assignment for ENSFALP00000010731 from Ficedula albicollis 76_1.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSFALP00000010731
Domain Number 1	Region: 42-101
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	6.1e-17
Family	Classic zinc finger, C2H2	0.014
Further Details:

Domain Number 2	Region: 183-233
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.00000000000777
Family	Classic zinc finger, C2H2	0.011
Further Details:

Domain Number 3	Region: 87-132
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.0000000112
Family	Classic zinc finger, C2H2	0.02
Further Details:

Domain Number 4	Region: 120-172
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.000000193
Family	Classic zinc finger, C2H2	0.014
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSFALP00000010731 Gene: ENSFALG00000010290 Transcript: ENSFALT00000010774
Sequence length	501
Comment	pep:known_by_projection scaffold:FicAlb_1.4:JH603266.1:2051804:2063352:-1 gene:ENSFALG00000010290 transcript:ENSFALT00000010774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGER PYKCTQQDCTKAFVSKYKLLRHMATHSPEKTHKCNYCEKMFHRKDHLKNHLHTHNPNKEA FKCEECGKNYNTKLGFKRHLALHAATSGDLTCKVCLQTFESTGVLLEHLKTHAGKSSGGV KEKKHQCEHCDRRFYTRKDVRRHMVVHTGRKDFLCQYCAQRFGRKDHLTRHMKKSHNQEL LKVKTEPMDLLDPFTCNVSVPIKDELLPVMSLPSSELTSKPFTNTLQLNLYNTQIQSMQS SASAHQMVATSLPLGMPCPIDMESVHPSHQLSLKYPLGTTSYSISMPEKEQPLKGEIESY LMELQSGMPSSSQDSQASSSKLGLDPQVGPLDDGSGEVSLSKGSVPISEPLNAPSLDFSQ LFNFIPVNGPPYNPSVSVGNLGMSYTQEEAHSSMTQLPPQTQDPQDPSNSIGLGSLHSLS AAFTSSLSTTTTLPRFHQAFQ
Download sequence
Identical sequences	U3K6S7 ENSFALP00000010731 XP_005042140.1.66865 XP_005418379.1.5688 XP_005479369.1.73095 XP_009083672.1.15306 XP_014120261.1.73095 XP_018765789.1.15306 XP_018765794.1.15306 XP_021411355.1.53032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]