SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|433626853|ref|YP_007260482.1| from Mycobacterium canettii CIPT 140060008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|433626853|ref|YP_007260482.1|
Domain Number 1 Region: 29-217
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.01e-40
Family Cutinase-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|433626853|ref|YP_007260482.1|
Sequence length 218
Comment Putative cutinase Cut1 [Mycobacterium canettii CIPT 140060008]
Sequence
MVTTWALLFAPVPAASADPPDPTVSAGACPDVEVVFARGTGEPPGVGGIGEDFVDALRSK
IGEKSMGVYGVDYPATTDFPTAMAGIYDAGTHVEQTAANCSQSKLVLGGFSQGAAVMGFV
TAAAIPDGAPLDAPRPMPPEVADHVAAVTLFGMPSVAFMHSIGAPPIVIGPLYAEKTIQL
CAPGDPVCSSGGNWAAHNGYADDGMVEQAAVFAAGRLG
Download sequence
Identical sequences gi|433626853|ref|YP_007260482.1| WP_015288154.1.35403 WP_015288154.1.45062 WP_015288154.1.60091 WP_015288154.1.71399 gi|433630857|ref|YP_007264485.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]