SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1aisA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1aisA
Domain Number 1 Region: 102-180
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 2.87e-40
Family TATA-box binding protein (TBP), C-terminal domain 0.00013
Further Details:      
 
Domain Number 2 Region: 10-88
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 2.7e-35
Family TATA-box binding protein (TBP), C-terminal domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1aisA   PDB: 1ais
Sequence length 182
Comment (A:)
Sequence
mvdmskvklrienivasvdlfaqldlekvldlcpnskynpeefpgiichlddpkvallif
ssgklvvtgaksvqdieravaklaqklksigvkfkrapqidvqnmvfsgdigrefnldvv
altlpnceyepeqfpgviyrvkepksvillfssgkivcsgakseadaweavrkllreldk
yl
Download sequence
Identical sequences 1aisA 1ais_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]